PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013636517.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 357aa    MW: 41333.1 Da    PI: 9.9035
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013636517.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.58.8e-15453148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                     r+rW+ eEd ll  +v+q+G++ W++++++m+  ++R +k+c +rw +yl
   XP_013636517.1  4 RQRWSGEEDALLRAYVRQFGPREWHLVSERMNkpLNRDAKSCLERWKNYL 53
                     89**********************************************97 PP

2Myb_DNA-binding36.41.2e-1159103147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+ T+eE+ l +++ +++G++ Wk+Ia++++ gRt+k +  +w  +
   XP_013636517.1  59 KGSLTEEEQRLVIRLQEKHGNK-WKKIAAEVP-GRTAKRLGKWWEVF 103
                      6788******************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.469153IPR017930Myb domain
SMARTSM007171.7E-13355IPR001005SANT/Myb domain
SuperFamilySSF466891.27E-21498IPR009057Homeodomain-like
CDDcd001673.27E-8653No hitNo description
Gene3DG3DSA:1.10.10.607.8E-20660IPR009057Homeodomain-like
PfamPF139213.6E-13767No hitNo description
PROSITE profilePS5129423.24854108IPR017930Myb domain
SMARTSM007173.2E-1058106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-1561102IPR009057Homeodomain-like
CDDcd001673.01E-763104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009615Biological Processresponse to virus
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010338Biological Processleaf formation
GO:0042742Biological Processdefense response to bacterium
GO:0045088Biological Processregulation of innate immune response
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0050832Biological Processdefense response to fungus
GO:0000793Cellular Componentcondensed chromosome
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MKERQRWSGE EDALLRAYVR QFGPREWHLV SERMNKPLNR DAKSCLERWK NYLKPGIKKG  60
SLTEEEQRLV IRLQEKHGNK WKKIAAEVPG RTAKRLGKWW EVFKEKQQRE EKESNKRVEP  120
IDESKYDRIL ESFAEKLVKE RSSVPAVMAS SNGGFQQAPP PPNNNHVIPP WLATSNNGNN  180
VVARPPSVTL TLSPSVAATP PQQPIPWLQQ QQPEASPGGL VLGSMIPSCS GSNESVFMSE  240
LVECCRELEE GHRAWAEHKK EAAWRLRRLE LQLESEKTSR QREKAEEIEA KMKALREEQK  300
MAMEKIEGEY REQLVGLRRD AEAKDQKLAD QWTSKHIRLT KFLEQHIGCR QRLLDRP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-15792789MYB PROTO-ONCOGENE PROTEIN
1mse_C3e-15792789C-Myb DNA-Binding Domain
1msf_C3e-15792789C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bol.150770.0leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT3509820.0KT350982.1 Brassica napus MYB transcription factor 91-2 (MYB91-2.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013636516.10.0PREDICTED: transcription factor AS1
RefseqXP_013636517.10.0PREDICTED: transcription factor AS1
RefseqXP_013692331.10.0PREDICTED: transcription factor AS1
SwissprotO809310.0AS1_ARATH; Transcription factor AS1
TrEMBLA0A078DS750.0A0A078DS75_BRANA; BnaC04g07760D protein
TrEMBLA0A0D3BR580.0A0A0D3BR58_BRAOL; Uncharacterized protein
STRINGBra005177.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.10.0MYB family protein